PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G306000.1
Common NamePHAVU_002G306000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 304aa    MW: 33717 Da    PI: 7.5267
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G306000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.71e-1665113148
                         TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+W++eEde l+++ k+ G+g +W t +++ g++R++k+c++rw++yl
  Phvul.002G306000.1  65 RGPWSPEEDETLKNYLKKNGTGgNWITLPQKAGLKRCGKSCRLRWLNYL 113
                         89*********************************************97 PP

2Myb_DNA-binding42.81.2e-13120162246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g +T+eEd+ +  +    G++ W++Ia+ ++ gRt++++k++w++
  Phvul.002G306000.1 120 GGFTEEEDQVICTLYSTIGSR-WSLIAAQLP-GRTDNDVKNHWNT 162
                         569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.11260113IPR017930Myb domain
SuperFamilySSF466892.03E-2762160IPR009057Homeodomain-like
SMARTSM007172.3E-1164115IPR001005SANT/Myb domain
PfamPF002497.1E-1565113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-2366120IPR009057Homeodomain-like
CDDcd001671.47E-867113No hitNo description
PROSITE profilePS5129421.216114168IPR017930Myb domain
SMARTSM007174.7E-12118166IPR001005SANT/Myb domain
PfamPF002494.8E-12120162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-23121167IPR009057Homeodomain-like
CDDcd001672.72E-9122164No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MCVSQTKSNF SNLPTSQSQS ILYYILLLHS PYSVLFFTFK SSVTSEPFAL AMGRAPCCDK  60
ANVKRGPWSP EEDETLKNYL KKNGTGGNWI TLPQKAGLKR CGKSCRLRWL NYLRPHIKHG  120
GFTEEEDQVI CTLYSTIGSR WSLIAAQLPG RTDNDVKNHW NTKLKKKFLV ANTNATVKTV  180
SPQFTTSTTP LSQVEDCVFD HKNSSESHVL SSEQTHIPVP SPLPLGSHLS GLGSTVPLSN  240
EVSIFSNSTS LVKQENQTQW FSYHDNTEGE NEALLLDFVY EDLLLSNGFV SQEKSSEIAP  300
SFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26651687108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007160258.10.0hypothetical protein PHAVU_002G306000g
TrEMBLV7CPX60.0V7CPX6_PHAVU; Uncharacterized protein
STRINGGLYMA05G36120.21e-120(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.13e-74myb domain protein 68